SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010065 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010065
Domain Number 1 Region: 182-439
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.58e-54
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 602-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-38
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010065   Gene: ENSDORG00000010710   Transcript: ENSDORT00000010710
Sequence length 878
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4531:90536:359845:1 gene:ENSDORG00000010710 transcript:ENSDORT00000010710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRVPPSVSLQEATQRKLKKFSELRGKPVAPGEFWDIVAITAADEKQEIAYRQQLSEK
LKRNELPLGVQYHVFVDPAGAKIGNGGSTLCALQSLEKLYRDKWSSFTILLIHSDEWKKK
VSESYIIIIERLQDDLQIKEKELTELRHVFGSEDAFNKVNLNYRTENGLTLFCGDNKSHI
RSLMLKGLCPSQLTRNGFTALHLAVYKDSAELITSLLHSGADIQQVGGGLKALHIAVIAG
HLEAADVLLQHGANVNVQDAVFFTPLHITAYHGHEQITRLLLKLGADVNISGEVGDRPLH
LASAKGLLNIAKLLMEDGNKADVNAQDNEDHVPLHFCAHFGHHDIVKYLLQSDLEVQPHV
VNIYGDTPLHLACYNGKFEVAKEIIQVTGTESLTKENIFSETAFHSACTYGKNIDLVKFL
LDQNVVNINHQGRDGHTGHDAIVTLLKHYKRPQDELPCNEYSQPGGDGSYVSVPSPLGKI
KNMTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XILDLKSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQS
LDEDNMTKQPGNLHWMAPEVFMQCTKYTIADVFNYALCLWELLTGEIPFAHLKPVAAAAD
MAYHHIRPPIGYFIPQPISSLLMRGWNVWPEGRPEFSEVVTKLEDCLCNIEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXALRSRFELEYALNARSYAACPQSVGLCPSQSLSLE
EMKRSLQHPIDKYGYVSDPMSPMHLYSCRNSGSFEDSS
Download sequence
Identical sequences ENSDORP00000010065 ENSDORP00000010065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]