SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010067 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010067
Domain Number 1 Region: 326-555
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.73e-79
Family PDEase 0.00000000126
Further Details:      
 
Domain Number 2 Region: 616-678
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000144
Family PDEase 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010067   Gene: ENSDORG00000010712   Transcript: ENSDORT00000010712
Sequence length 737
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5997:11119:222746:1 gene:ENSDORG00000010712 transcript:ENSDORT00000010712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSRSVMTVTADADNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQ
SERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLV
LHATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSV
RNNFTLLTNLHGTSNKRSPAASQPSVSRVNLQEESYQKLAMETLEELDWCLDQLETIQTY
RSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKK
KKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYS
HNRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTH
VLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHH
LAVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVT
SSGVLLLDNYTDRIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQS
PSPPLDERNRDCQGLMEKFQFELTLEEEDSEGPEKEGEGHNYFSSTKTLCVIDPENRDSL
GETDVDIATEDKTPIDT
Download sequence
Identical sequences ENSDORP00000010067 ENSDORP00000010067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]