SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010082 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010082
Domain Number 1 Region: 3222-3347
Classification Level Classification E-value
Superfamily Cadherin-like 2.96e-35
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 2280-2386
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 2807-2915
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 1557-1662
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1763-1883
Classification Level Classification E-value
Superfamily Cadherin-like 5e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 138-259
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 2073-2180
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-24
Family Cadherin 0.0022
Further Details:      
 
Domain Number 8 Region: 3030-3129
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 457-549
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-22
Family Cadherin 0.00095
Further Details:      
 
Domain Number 10 Region: 1451-1555
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 2180-2287
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 12 Region: 2388-2496
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 13 Region: 1664-1785
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 2490-2600
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 15 Region: 2588-2698
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 16 Region: 1359-1457
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-18
Family Cadherin 0.0063
Further Details:      
 
Domain Number 17 Region: 1234-1354
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 18 Region: 1876-1974
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 19 Region: 3161-3234
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000106
Family Cadherin 0.0029
Further Details:      
 
Domain Number 20 Region: 1141-1246
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0052
Further Details:      
 
Domain Number 21 Region: 563-664
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000353
Family Cadherin 0.0034
Further Details:      
 
Domain Number 22 Region: 1982-2085
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000728
Family Cadherin 0.002
Further Details:      
 
Domain Number 23 Region: 2707-2805
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000371
Family Cadherin 0.0046
Further Details:      
 
Domain Number 24 Region: 3437-3491
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000271
Family Cadherin 0.0028
Further Details:      
 
Domain Number 25 Region: 367-464
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000004
Family Cadherin 0.0029
Further Details:      
 
Domain Number 26 Region: 4132-4170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000158
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 27 Region: 2915-2965
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0018
Further Details:      
 
Domain Number 28 Region: 4097-4136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000228
Family EGF-type module 0.016
Further Details:      
 
Domain Number 29 Region: 4058-4094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 30 Region: 3407-3444
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000005
Family Cadherin 0.0096
Further Details:      
 
Domain Number 31 Region: 34-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000985
Family Cadherin 0.006
Further Details:      
 
Domain Number 32 Region: 4019-4058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.018
Further Details:      
 
Domain Number 33 Region: 246-355
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000138
Family Cadherin 0.0078
Further Details:      
 
Domain Number 34 Region: 3816-3880
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000543
Family Laminin G-like module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010082   Gene: ENSDORG00000010728   Transcript: ENSDORT00000010727
Sequence length 4565
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_773:1331:85762:-1 gene:ENSDORG00000010728 transcript:ENSDORT00000010727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRDLALLLLLLLFLQHFGDSHGSQKLEQTPSLQFTHFQYNVTVHENSAAKTYVGHPVKM
GIYITDPSWELRYKIVSGDNENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKVHYTLV
IKAVEKITNAEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIG
TNGEFYYSFKDRTDMFAIHPSSGVVLLTGSLDYTETKLYELEILAVDRGMKLYGSSGISS
MAKLTVHVEQANECAPVVTAVTLSPSELDKDPTFAIVTVEDCDQGVNGEIASLTIVAGDL
HQQFRTVRSFPGSKEYKVKAVGSIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVASPQ
FKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPSYSHLRYIFKSAPGKVRFNINHNTGL
ISVLEPIKRQQASHFELEVLTSDRKASTKVLVKVLGVNSNPPEFSQTAYKASFDENTPIG
TTVMSVNAVDPDEGENGYVTYSIANLNHVPFVIDHFTGAVSTSENLDYELMPRVYTLRIR
ASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTVPRDLSVGEQITTVSAIDADEL
QLVRYQIETGNELDLFDLNPNSGVLSLKQSLMDGLGAKMSFHSLRITATDGENYATPLYI
NITVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQEDMEDVFFDSHSVNAHAPQFRST
LPTGIEVKENHPVGSSIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQT
SEPVYYPEIVENAPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTXXXXXX
XXXXXXXXXXXXXXXVTVTDNGVPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPERDK
LERERNAKREPLYRVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKKFSAAGE
YDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSPEPISFEESVFTFTVMESDPVAHMIGV
ISVEPPGTPLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTSTIL
TQVFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILQISAMDKDEKNKLIYTLQSSIDP
LSLKKFRLDPATGSLYTSEKLDHEAIHQHILTVMVRDQDVPVKRNFARIIVNVSDTNDHA
PWFTSSSYEGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNFGNIGNSFTIDPIL
GSLKTAKELDRSNQLEYDLIVKATDQGDPPLSEITSVHIIVTIADNASPKFTSKEYSVEI
SETISIGSFVGMVTAHSQSSVVYEIKDGNLGDAFDINPHSGSIITQKALDFETLPVYMLT
VQGTNMAGLSTNSTVLVHLQDENDNSPVFIQPEYSGLISESASINSVVLTDSNAPLVIRA
TDADKESNALLVYHIVEPSVHKYFAIDSSTGAIHTVLSLDYEETSVFHFTVQVHDMGTPR
LFAEYAANVTIHVIDINDCPPVFSRSLYETSLLLPTYKGVKVITVNATDADSSAFSQLIY
SITEGNIGEKFSMDYKTGTITVQNTTQLRSRYELTIRASDGRFTSFTSVKVNVKESKESQ
LKFTQDFYSAKVKENSTEARTLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTG
LPFDREQQELFDVVVEVTQEHKPSAVAHVIVKVTVEDQNDNAPVFVNLPYYAVVKVDTEV
GHIIRSVTAVDRDSGRNGEVHYYLKEHHDHFQIGPSGEISLKKQFELDTLNKEYLVTVVA
KDRGNPPFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQMHSPVVHIQANSPEGLKVFY
SITDGDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIIVEDI
NDNPPVFVQLSYSATLSEASVIGTSVVQVRATDADSEPNRGISYQMFGNHSKSHDHFHID
SSTGLISLVRTLDYEQFPQHKIYVRAVDGGMPQLSSEVIITVDVTDLNDNPPLFDQQIYQ
AKISEHAAHGHFVICVKAYDADSTDIDKLEYSIVSGNDHKNFVIDSKTGIITLSNLRRHT
LKPFYALNVSVSDGVFRSSVQVHVTVIGSNLHSPVFLQNEYEVELAENAPLHTLVVEVKA
TDRDSGIYGHITYHIVNDFAKDRFYINDRGQIFTSEKLDRETPTEKVISVRLMAKDAGGK
VAFCTINVILTDDNDNAPQFRATKYEVNVGSSVAKGTSVIKVFASDADEGSNADVTYTIE
ADSESVMENLEINTLSGIITTKESLVGLENEIFTFFVRAVDNGSPSKESVVPVYVKILPP
EIKLPKFSEPFYTYTVSEDMPIGTEIDLIRAEHSGAVLYSLIKGNTPESNRDEFFVIDRQ
SGRLKLEKRLDHETTKWYQFAILARCIHDDYEVVASVDVSIQVKDANDNSPVLESNPYEA
FIVENLPGGSKVIQVRASDLDSGANGQIMYSLDQSQSVDIIESFAINVETGWITTLKELD
HEERRSYQIKVVASDHGDKVQLSSTALVDVTVTDVNDNPPRFTAEIYKGTVSEDDPPGGV
IAILSTTDADSEEINRQVTYFITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLYSDTIPEDALPGKLIMQVSATDADIRSNA
EITYTLFGSGAEKFKLNPDTGELKTLAPLDREEQAVYHLLVKATDGGGRFCQANIVLMLE
DVNDNAPEFTADPXXXXXXXXXXXXXXXXXXXXXXXXXXLNRKISYSLIDSADEQFSINE
LSGIIQLERPLDREVQAVYTIILKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYG
ATVSEDILIGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAIFIIENLDYE
SSHEYYLTIQATDGGTPSLSDLATVNINVTDINDNTPVFSQDTYTTVISEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISGYTLTVQASDNG
SPPRVNTTTVNIDVSDVNDNPPIFSKGNYSVIIQENKPVGFSVLQLVVTDRDSSHNGPPF
FFTIVSGNEDQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR
TAVCLCTEGKCPPVHHGCDGNPCPAGSECIADPREEAYTCVCPGGRLAQCPGSSSVTFTG
NSFVKYRLMENENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLNSKPRSYAHMEESVDISPGCLLTATE
DCSSNPCQNGGICNPSPTGGYYCKCSALYIGTYCEVSVNPCSSNPCLYGGTCVVDNGDFV
CQCRGLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECVGNP
CRNGALCENTHGSYHCNCSHEYRGKHCEDAAPNQYVSTPWNIGLAEGIGIVVFVAGIFLL
VVVFVLCRKMISRKKKHQAEPEDKHLGQTTAFLQRPYFDSKLNKNIYSDIPPQVPVRPIS
YTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKTVAVCSVAPNLPPPPPSN
SPSDSDSIQKPNWDFDYDTKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSES
CDDNGYHWDTSDWMPAVPLPDIQEFPNYEVIDEHTPLYSADPNTIDTDYYPGGYDIESDF
PPPPEDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYP
VDMSEPQKKATSENSTCRESLAPAYPPGYQRNFEAPAIENMPMSVYASTASCSDVSACCE
VESEV
Download sequence
Identical sequences ENSDORP00000010082 ENSDORP00000010082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]