SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010089 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010089
Domain Number 1 Region: 424-501,536-623
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-49
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 218-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 11-51,176-209
Classification Level Classification E-value
Superfamily RING/U-box 3.16e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010089
Domain Number - Region: 260-382
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0615
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010089   Gene: ENSDORG00000010736   Transcript: ENSDORT00000010736
Sequence length 626
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_10694:22433:32829:-1 gene:ENSDORG00000010736 transcript:ENSDORT00000010736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDREELD
REEEEEDGEEEEVEAVGAGGGWDTPMRDDDYEGDMEEEVEEEEEGLFWNGGMGGSNWENM
DYVWEEDEEEEDLNYYLGDMEDLMGEEEDEEVLEEDEEEELDPVTPLPPPPAPRRCFTCP
QCRKSFPRRSFRPNLQLANMVQVIRQMHPNPGRANRVNEQGICPKHQEALKLFCEVDEEA
ICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVTELKS
QMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLSRLL
AEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEIWSPDPCQPHSHDFLTDAIVRKMSRM
FCQAARVDLTLDPDTAHPALLLSPDRRGVRMAERRPEVADHSKRFSSDCCVLGAQGFRSG
RHYWEVEVGGRRGWAVGAARESTHHKEKMGPGGSSVGSGDASSSRHHHRRRRLHLPQQLL
LQREVWCVGTHGKRYQAQSSTEQTLLSPCEKPRRFGVYLDYEAGRLGFYNAETLAHVHTF
SAAFLGERVFPFFRVFSKGTRIKLCP
Download sequence
Identical sequences ENSDORP00000010089 ENSDORP00000010089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]