SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010114 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010114
Domain Number 1 Region: 126-232
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 9.68e-31
Family Inhibitor of apoptosis (IAP) repeat 0.00000125
Further Details:      
 
Domain Number 2 Region: 22-100
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 8.9e-25
Family Inhibitor of apoptosis (IAP) repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 243-287
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0000000131
Family Inhibitor of apoptosis (IAP) repeat 0.00014
Further Details:      
 
Domain Number 4 Region: 322-340,431-468
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.000000105
Family Inhibitor of apoptosis (IAP) repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010114   Gene: ENSDORG00000010762   Transcript: ENSDORT00000010762
Sequence length 493
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1228:22967:38354:1 gene:ENSDORG00000010762 transcript:ENSDORT00000010762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNNCEGSKTCIPADINKDEEFVEEFNRLKTFANFPSSSPVAASTLARAGFLYTGEGDTV
QCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFESSAAQSSNPGVQNGQYKAENYL
GSRNHFTLDRPPETHADYLLRTGQVVDISDTIYPRNPSMCSEEARLKSFHNWPDYAHLTP
RELASAGLYTGIDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESDV
SSDRNYPNSTHLPRNPAMADYEARIITFGTWIYSVNKEQLASAGFYALXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCKYLLERKGQEYINNIHLTHSTEESLXXXXXXXXXXXX
XXXDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQTSGSNYISLEILVADLVNAQKDNTQD
ESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPMC
YTVITFKQKIFMS
Download sequence
Identical sequences ENSDORP00000010114 ENSDORP00000010114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]