SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010147 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010147
Domain Number 1 Region: 879-1150
Classification Level Classification E-value
Superfamily RNI-like 1.12e-38
Family 28-residue LRR 0.0063
Further Details:      
 
Domain Number 2 Region: 354-471
Classification Level Classification E-value
Superfamily Ankyrin repeat 6e-33
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 4-127
Classification Level Classification E-value
Superfamily TPR-like 0.000000000073
Family Transcription factor MalT domain III 0.054
Further Details:      
 
Domain Number 4 Region: 143-264
Classification Level Classification E-value
Superfamily TPR-like 0.0000000034
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010147   Gene: ENSDORG00000010793   Transcript: ENSDORT00000010799
Sequence length 1203
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3810:14347:26335:-1 gene:ENSDORG00000010793 transcript:ENSDORT00000010799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRLYLNLGLTFERLQQMALCNDYFKKSIFLAEQNHLYEDLFRARYNLGAIHWCAGQHS
QAMRCLEGARECARAMKMRFMESECCVTISQILQDLGDFLAAKRALKKAYRLGSQKHAQR
AAVCQSLKYVLAVIQLQQRLEEAEGSDPQGALAICEQLGDLFSKAGNFPKAAEAYQKQLR
VAERLDRPDLELAIIHVSLATTLGDMKHRQAVHYEEELRLRKGNALEEAKTWFNIAVSRE
EAGDAYELLAPCFQKAVSCAEQAQQPWLQRQVLQHLHAVQLRLQPQEAPGTETKLQELSV
AEGEEEEEEEEAEAGEALDTSELELSESEDDTTSLSRPLEDEELQGYLGRRQVNKWNQRN
DLGETLLHRACIEGHLRRVQDLVRRGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGA
AVNDPGGQGCDGITPLHDALNCGHFEVAELLIQRGASVTLRTKKGHSPLETLQHWVKLYQ
RDLDLETRQKAAAMQRKLQAASSGSAPDGSLTSHVPSDHLFDPEISPPSSPCLCIPRPAE
APLVPSRVSPEQVTPAVARPRKGRHRPASSSSSSSEDEDCVGTLRPSQKKHRASGVMWVV
RKPGPTNSKEAAAVHAGRATCKAAIRGEGSAQSRCLSSCPPRDSGEAPSSPAALIPEEEY
LSEDWLELDTPLTRSRLPRLPRPQGSWDNRRPSASGSAEEERPVRPQAWSKQSHLACVPS
KAGAGSLATEPQRIPSAPRVLGPSGENLAAGQSSVLIQPPSIRVRVRIQDHLFLIPVPHS
SDVHSVAWLADQAAQRYYQTCGLLPRLTLRKEGALLASQDPIPDVLQSDDEVLAEVTSWD
LPPLTDRYRRACQSLGQGEHQWVLQAMECQGSSPSFSACSLALRQAQLTPLLRALKLHAV
LRELHLAGNRLGDGCVPELLAALGTMPSLAILDLSSNHLGQEGLHQLAGGPLGQAALKNL
EELDLSMNPLGDSCGQALASLLRACPLLSTLRLQACGFSSSFFLNHQAALSSAFQDAEHL
KTLSLSYNALGPPALARVLQSLRVRTLLHLELGSVAASKSNLGLMDSVVSYLTKEGCTLT
HLTLSANYLGDKAVRELSRCLPLCPTLISLDLSANREISSVGLGELLSALQERPQGLSFL
GLSGCSVGGPLGAGLWDAAVARLRELQLCSRAVCSEDRAALRLRLPPGAAALGRGPLLFF
RGL
Download sequence
Identical sequences ENSDORP00000010147 ENSDORP00000010147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]