SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010154 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010154
Domain Number 1 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000321
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 285-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000269
Family SPRY domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010154   Gene: ENSDORG00000010806   Transcript: ENSDORT00000010806
Sequence length 325
Comment pep:novel scaffold:dipOrd1:scaffold_176910:130:1182:1 gene:ENSDORG00000010806 transcript:ENSDORT00000010806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDTAQAFQKELRCAICINTFIDPVTLECGHSFCRPCLGLCWEETQTPATCPVCRGPCQ
QRDLKTNVVLRSLVAIARRASLRHFLSSEEYMCGTHRETKQMFCEVDRALLCRSCSQSQE
HRAHKHHPIERAAEEQREMISKQMHAVWEKTQENQHNLQEKRRMTKDVFRVLLLELGVQE
EERHHSQLLINEGRAMLLQLRERETQMLQKKHHLRNMYQKLIETYQKPDVDLLQCEPVLF
FLPLPLRPELSAPPIPGLIERLSQYQVEIAFNEAGIKILGAVWTRHAVLNSEESFHFTAF
GHQVFSSGKHYWEVSVDDSSTWALG
Download sequence
Identical sequences ENSDORP00000010154 ENSDORP00000010154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]