SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010156 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010156
Domain Number 1 Region: 114-324
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.09e-19
Family Gastric lipase 0.00000434
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000855
Family Gastric lipase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010156   Gene: ENSDORG00000010809   Transcript: ENSDORT00000010808
Sequence length 328
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6878:3701:15653:-1 gene:ENSDORG00000010809 transcript:ENSDORT00000010808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPVVYLQHAFIADSSNWVSNTDNNSLGFMLADAGFDVWMGNSRGNTWSRKHKLSVSQDE
FWAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIGFSQMPELA
KKIKMFFALAPVVSLVFSSSPLTKLGLFPEDFLKAILGHTEVFSDNPIIKWLSIHFCTHA
ILKELCGNVFFLVSGFDEKNLNMSRLDVYGSHNPAGTSVQNALHWRQXXXXXXXXXXXXX
XXXXXXXXXXXSYPPMYNVKDMTVPIALWNGARDWLADANDIHILLTQIPNLVYHKEILE
YNHIDFIFGMSTHWMVYDKIINMMKKYQ
Download sequence
Identical sequences ENSDORP00000010156 ENSDORP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]