SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010164 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010164
Domain Number 1 Region: 142-454
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-125
Family Transglutaminase core 0.0000000000291
Further Details:      
 
Domain Number 2 Region: 3-140
Classification Level Classification E-value
Superfamily E set domains 3.22e-42
Family Transglutaminase N-terminal domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 468-582
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.2e-31
Family Transglutaminase, two C-terminal domains 0.00000391
Further Details:      
 
Domain Number 4 Region: 583-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-29
Family Transglutaminase, two C-terminal domains 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010164   Gene: ENSDORG00000010816   Transcript: ENSDORT00000010816
Sequence length 684
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_769:138006:162119:-1 gene:ENSDORG00000010816 transcript:ENSDORT00000010816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILERCDLELEANGRDHHTADLCQDRLVVRRGQAFWLTLHFEGRGYEAGVDSLTFSAVTG
PAPSEEAGTKARFPLSDGVGEGGWAASVADQQDNVLSLHLYTPAEAPIGLYRLSLETSTG
YQGSSFVLGHFTLLFNAWCPADAVYLNAEAERQEYVLNQQGFIYQGSAKFIKSVPWNFGQ
FEDRILDTCLTLLDVNPKFLKDSSRDCARRSSPIYLGRVVSAMVNCNDDQGVLLGRWDNN
YGDGVSPMSWIGSVDILRRWKDHGCQHVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSA
HDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLEPGYEGWQAIDPTPQEK
SEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSLHKSVNRSLVVGL
KISTKSVGRDDRQDITHTYKYPEGSPEEREAFTKNHLNRLEEKVEVQEGVDMRIRVGQSM
AVGSDFDVFAHITNNASESRDTRLVLCARIVSYNGVLGPECGTMDPLDLTLEPFCEKSIP
LRILYEKYSDYLTESNLIKVRGLLIEPAANNYLLAERDLYLENPEIKIRMLGEPKQNRKL
VAEVALKNPLTVPLLGCIFTVEGAGLIKEQKIVEVPDPVEAGEEVKVRVDLIPFDMGLHK
LVVNFDCDKLKAVKGYRNVIIGPA
Download sequence
Identical sequences ENSDORP00000010164 ENSDORP00000010164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]