SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010181 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010181
Domain Number 1 Region: 10-83
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-19
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 2 Region: 283-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-16
Family SPRY domain 0.0007
Further Details:      
 
Domain Number 3 Region: 77-134
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000366
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010181   Gene: ENSDORG00000010834   Transcript: ENSDORT00000010834
Sequence length 482
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5655:302:7513:1 gene:ENSDORG00000010834 transcript:ENSDORT00000010834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAAAPGLLRQELSCPLCLQLFEAPVTAECGHSFCRACLGRAGGEPAADGSVPCPSCQA
PTRPQALSTNQQLARLVEGLAQVPQGLCEEHRDPLSIYCEQDRALVCGVCASLGAHRGHR
LLPAAEAHTRLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLQKILSESPPPARLDIQLPIISDDFKFQVWKKMFRALMPALEEMTLDPSST
HTNLMVSPSDRRVQSAEHKGTAETEVSKDDLHLNKAMALVEHQSLSEVEHYCDVDVGDNP
RWSLGVIKSEAPRCGVRLHALPLLGMWLLVMRDGTVLEAHVDAKEPRALRTEVRPARMGF
YFSFSDCVLALYDASVADDLQPLFAFLECLLGPVYPLFDVCWHDKGKNAQPLLLVGPEGH
EA
Download sequence
Identical sequences ENSDORP00000010181 ENSDORP00000010181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]