SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010184 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010184
Domain Number 1 Region: 110-310
Classification Level Classification E-value
Superfamily Carbamate kinase-like 3.95e-20
Family N-acetyl-l-glutamate kinase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010184   Gene: ENSDORG00000010837   Transcript: ENSDORT00000010837
Sequence length 521
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4472:14397:19614:1 gene:ENSDORG00000010837 transcript:ENSDORT00000010837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTWVAATLRTGAAGVRLRGIRRLSGSTGRRAAASGSPGRRLSTAWARAQPPREEAEGT
ENSGQSPATEQPSWTPPPPPPESPAPPAGRSLVQRDIQAFLNQCGASPGEARHWLTQFQT
CQYSADKPFAVIEVDEEVLRCPQAVSSLAFALAFLQRMDMKPLVVLGLPAPTAPSGCLSF
WEAKTQLAQSCKVLVDELRHNAATAVPFFGGGSVLSAAEPAPHASYGGIVSVETDLLQWC
LESNSIPILCPIGETSARRSVLLDSLEVTASLAKALQPTKIIFLNNSGGLRNTSQKVLSS
VNLPADLDLVTTAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNAAAL
TVDPVGATPYLDKFVVGSSRQGQGSGQMLWELRQLQTLFWRSRVTNPINPWYFKHSDGSF
SNKQWIFFWFGLADIRDSYELVNHAKGLPDSFCKPASDPGS
Download sequence
Identical sequences ENSDORP00000010184 ENSDORP00000010184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]