SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010221 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010221
Domain Number 1 Region: 92-134
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000702
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010221   Gene: ENSDORG00000010876   Transcript: ENSDORT00000010875
Sequence length 386
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6676:104841:135170:-1 gene:ENSDORG00000010876 transcript:ENSDORT00000010875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHIKKGELTQEEKELLEVIXXXTVQEAGTLLSTKNVRVNCLDEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKDITWVMLEAGAETDVVNSVGRTAAQMA
AFVGQHDCVTIINNFFPRERLDYFTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVM
LVNENPLLADEAALNKCYKVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKCINFLKDGE
NKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTA
FAVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGLDVS
Download sequence
Identical sequences ENSDORP00000010221 ENSDORP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]