SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010234 from Dipodomys ordii 76_1

(show help)
Strong hits

Sequence:	ENSDORP00000010234
Domain Number 1	Region: 31-77
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000143
Family	LIM domain	0.0015
Further Details:

Domain Number 2	Region: 110-148
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000065
Family	LIM domain	0.0079
Further Details:

Domain Number 3	Region: 149-181
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000255
Family	LIM domain	0.002
Further Details:

Domain Number 4	Region: 4-30
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000642
Family	LIM domain	0.0088
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSDORP00000010234 Gene: ENSDORG00000010889 Transcript: ENSDORT00000010889
Sequence length	211
Comment	pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3720:41007:43430:-1 gene:ENSDORG00000010889 transcript:ENSDORT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSWTCPRCQQPVYFAEKVSSMGKNWHRFCLKCERCHSVLSPGGHAEHNGRPYCHKPCYGA LFGPRGVNIGGVGCYIYNLPTPPANSTPLSPSDFSPPRPRTGLPQGKKSPPHMKTFTGET SLCPGCEKPVYFAEKVMSLGRNWHRPCLRCQRCQKTLTAGRHAEHDGIPYCHIPCYGYLF GPKGGWPHPRPRPKVHVHDLYGCVLNFPYGQ
Download sequence
Identical sequences	ENSDORP00000010234 ENSDORP00000010234

SEARCH