SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010283 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010283
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.32e-38
Family Matrix metalloproteases, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 267-383
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.24e-33
Family Hemopexin-like domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010283   Gene: ENSDORG00000010941   Transcript: ENSDORT00000010939
Sequence length 383
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6505:976:4357:1 gene:ENSDORG00000010941 transcript:ENSDORT00000010939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTFPRDSPLGRDTVRALMYYALKVWSDITPLNFHEVAGNAADIQIDFSRAEHEDRYPFD
GPGGTVAHAFFPGDHRAAGDAHFDDDETWTFRSSDSHGMDLFAVAVHEFSHAIGLSHVAA
SSSIMQPYYRGPVGDPLRYGLPYEDRVRAWQLYGVRESVSPTAQLDTPEPEEPPLLPEPP
ENRSSTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDRYWVFNDNNVEEGYPRPISDFSFPGGVDAFSQE
HNDRTYFFKDQLYWRYDDHTRRMDPGYPVQGPLWRGVPSPPDDAMRWSDGASYFFRGQEY
WVLDGELEVPGYPQSTARDWLVC
Download sequence
Identical sequences ENSDORP00000010283 ENSDORP00000010283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]