SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010290 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010290
Domain Number 1 Region: 2355-2433,2535-2611,2709-2734,2768-2815
Classification Level Classification E-value
Superfamily Sialidases 0.0000000378
Family Sialidases (neuraminidases) 0.047
Further Details:      
 
Domain Number 2 Region: 582-618,785-852,935-964,1006-1034,1147-1172
Classification Level Classification E-value
Superfamily Sialidases 0.000000647
Family Sialidases (neuraminidases) 0.034
Further Details:      
 
Domain Number 3 Region: 1150-1168,1254-1366,1677-1732
Classification Level Classification E-value
Superfamily Sialidases 0.00000116
Family Sialidases (neuraminidases) 0.039
Further Details:      
 
Domain Number 4 Region: 1677-1791,1871-1979,2022-2083,2240-2272
Classification Level Classification E-value
Superfamily Sialidases 0.0000745
Family Sialidases (neuraminidases) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010290
Domain Number - Region: 671-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1029-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00199
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 2585-2639,2764-2789,2943-3017,3349-3366
Classification Level Classification E-value
Superfamily Sialidases 0.00275
Family Sialidases (neuraminidases) 0.023
Further Details:      
 
Domain Number - Region: 2126-2157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010290   Gene: ENSDORG00000010945   Transcript: ENSDORT00000010946
Sequence length 3449
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6816:20158:2565559:-1 gene:ENSDORG00000010945 transcript:ENSDORT00000010946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGWAPRTFLLAVVLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAG
NPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVESSQSIGGSNAFGFGIMSEHQFGNQ
FMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQGAP
TEASAHPHLXXXXXXXXXXXXXXXXXXXXXXXXXXXVECNNCETGEQCGTIMHGNAVTFC
EPYGPRELTTTSLNTTTASVLQFSIGSGSCRFSYSDPSIIVSYAKNNTSDWIQLEITAPS
NVSTIIHILYLPEDAKGENIQFQWKQENLHVGEVYEACWALDNILVINSAHRQVILEDSL
DPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQWSEEF
ESQPTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIC
DPGDSHENDIILYAKIEGRKEHIALDTLSYSSYKVPSLVSVVINPELQTPATKFCLRQKN
HQGHNKNVWAVDFFHVLPVLPSTLSHMIQFSINLGCGTHQPGNSVSLEFSTNHGRSWSLL
HTECLPECAPHLPHSTVYSSENYSGWNRITIPLPNAALTRDTRIRWRQTGPILGNMWAID
NVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSSRLSSYHNF
YSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSKSVLSTCK
APDQPGEGVLLHYSYDNGITWKLLEHYSYLSYHEPRIISVELPDDARQFGIQFRWWQPYH
SSQGEDVWAIDEIIMTSVLFNSISLDFSNLVEVTQSLGFYLGNVQPYCGHDWTLCFTGDS
KLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTWHLVQEE
CLPSMPSCQEFTSASIYHASEFTQWRRVIVLLPQKTWSSATRFRWSQSYYTAQDEWALDS
IYIGQQCPNMCSGHGSCDHGMCRCDQGYQGTECHPDAMLPSTIMSDFENQNGWESDWQEV
IGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGESAACNKP
DSREEGVLLQYSNNGGIQWHLLAEMYFSDFSRPRFVYLELPAAAKTPCTRFRWWQPVFSG
EDYDQWAVDDIIILSEKQKQVIPVVNPTLPQNFYEKPAFDYPMNQMSVWLILANEGMVKN
ETFCAATPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCASQFSNTAPVFLQYSHD
AGMSWFLVKEGCFPASAGKGCEGSSRELSEPTIYHTGDFEEWTRITIIIPRSLASSKTRF
RWIQESSSQKNVPPFALDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGTCASNVPN
HSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGKSLYFNGPGKREARTVPLDTRNIRLV
QFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWHLLRELDFMSFLEPQIISIDLPR
EAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANWYRIQGG
QVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKPFSEAHSVQLQY
SLNNGKDWHLVTEECAPPTIGCLHYTESSIYTSERFQNWKRITVYLPFSTNSPRTRFRWI
QANYTVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGPYCVPVVPLPSILKD
DFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTNTMYVQFSL
RFIAKGTPERSHSILLQFSVNGGIIWHLMDEFYFPQTTNILFINVPLPYSAQTNATRFRL
WQPYNNGKKEEIWIVDDFIIDGNNLNNPVILLDTFDFGPREDNWFFYPGGNIGLYCPYSS
KGAPEEDSAMVFVSNEIGEHSITTRDLNVNENTIIQFEINIGCSTDSSSADPVRLEFSRD
FGATWHLLLPLCYHSSSHISSLCSTEHHPSSTYYAGTTQGWRREVVHFGKLHLCGSVRFR
WYQGFYPTGSQPVTWAIDNVYIGPQCEEMCNGHGSCINGTKCICDPGYSGPTCKISTKNP
DFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLMTRDLDLSHARFV
QFFMRLGCGKGVPDPRSQPVLLQFSLNGGLSWNLLQEFLFSNSSNVGRYIALEIPLKARS
GSTRLRWWQPSENGHFYSPWVIDQILIGGNISDNTVLEDDFTTLDSKKWLLHPGGTKMPV
CGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAASCSVTDSCYAIELEYSVDLGLS
WHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPPYTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCSRLLVTVDLNLTNAEFIQFYFMYGCLIT
PNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKETATRFRWWQPKHD
GLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFDMFMEDKTS
VNEHWLFHDDCTVERFCESPDGVMICGSHDGREVYAVTHDLTPTEGWIMQFKISVGCKVS
EKIAQNQIHVQYSTDFGVSWNYLVPQCLPADPKCSGTVSQPSVFFPTKGWKRITYPLPES
LVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTFLKERFDSEEIKPDLWMSLEGGSACTECGILAEDTALYFGGSTVRQAITQDLDLRG
AKFLQYWGRIGSENNMTTCHRPICRKEGVLLDYSTNGGITWTLLHEMDFQKYISVRHDYI
LLPEDALTNTTRLRWWQPFVISNGIVVSGVERAQWALDNILIGGAEINPSQLVDTFDDEG
TSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMMQFKIVV
GCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATIYNAVNSS
SWKRITIQLPDHISSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANWEIIQGISGCGQLAYAHGDSLYFN
CQIRQAATNPLDLTRASKIMFVLQIGSTSQTDSCNSDLSGPHAVDKAVLLQYSVNNGITW
HVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWALDHVEVVLSSTR
KQNYMMNFSRQHGLRHFYNRRRRSLRRYP
Download sequence
Identical sequences ENSDORP00000010290 ENSDORP00000010290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]