SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010317 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010317
Domain Number 1 Region: 415-684
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.34e-102
Family Neutral endopeptidase (neprilysin) 0.00000032
Further Details:      
 
Domain Number 2 Region: 161-370
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.1e-40
Family Neutral endopeptidase (neprilysin) 0.0004
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.61e-19
Family Neutral endopeptidase (neprilysin) 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010317   Gene: ENSDORG00000010976   Transcript: ENSDORT00000010976
Sequence length 684
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1245:5030:180669:1 gene:ENSDORG00000010976 transcript:ENSDORT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVMSKVNLSVNPCDNFFRFACDGWINNNPIPEDMPSYGVYPWLRHNVDLKLKALLEKSI
SRRRDIEAIQKAKILYSSCMNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNQATLSLAVREDYLDNSTEAK
SYRDALYKFMVDTAVLLGANSSRAEHDMKSVIRLEMKIAEIMIPHENRTSEAMYNKMNIS
ELSAMIPQFDWLGYIKKVIDVRLYPHLTDIGPSNVVVRVPQYFKDLFRILGSERNTTIAN
YLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCVNFIESALPYVVGKMFVD
VHFQEDKKEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKVGYEFIMND
THVNEDLKAIKFSESDYFGNVLQTRKYLAQSDFFWLRKAVPKTEWFTNPTTVNAFYSAST
NQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSL
DSEEKFKEKTKCMINQYSNYYWKKAGLNVKGKRTLGENIADNGGLREAFRAYRKWIHDKR
QGVEEPLLPGITFTNNQLFFLSYAHVRCNSYRPEAAREQVQIGAHSPPQFRVNGAVSNFE
EFQKAFNCPPNSTMNRGMESCRLW
Download sequence
Identical sequences ENSDORP00000010317 ENSDORP00000010317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]