SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010347 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010347
Domain Number 1 Region: 358-490
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-43
Family Eukaryotic proteases 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010347   Gene: ENSDORG00000011007   Transcript: ENSDORT00000011007
Sequence length 503
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1435:6649:66740:1 gene:ENSDORG00000011007 transcript:ENSDORT00000011007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQIFSPPLPLQALWERSALKIHCHPSLCLDPIFEPAPSCGHDQGLTLEPRWMPRIGGGQS
PPGVSPFISPQGPPRPRRPARESLMKVRDMAEKEGGRRVQGCSGPKVAALSVGTLLLLTA
IGAASWAVVTLLRSDQQPLYPEQVSPDARVTGFDRMEGTWRLLRSSRSYSRVAGLSCEEM
GLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYI
QPVCLPAAGQDLVDGKICTVTGWGNMQYYGQQARVLQEARVPIISNDVCNGPDFYGNQIK
PKMFCAGYPEGGVDACQGDSGGPFVCEDSISRAPRWRLCGIVSWGTGCALAQPGVYTKVM
DFREWIFQAIXTHSEASGILSHR
Download sequence
Identical sequences ENSDORP00000010347 ENSDORP00000010347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]