SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010364 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010364
Domain Number 1 Region: 40-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 3-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000312
Family EGF-type module 0.043
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010364
Domain Number - Region: 324-618
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000229
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010364   Gene: ENSDORG00000011026   Transcript: ENSDORT00000011026
Sequence length 634
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5595:5027:53838:-1 gene:ENSDORG00000011026 transcript:ENSDORT00000011026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSGHHNCHSSAHCLNKAGGYECRCRRGWRPIPGSPEGPTHTQCEDVDECRSGQHQCHSSA
VCVNTVGSYRCRCPPGWRVVFPAWTAPPGIHSPFLEEMQNLTRDFQSHTARDTADAIQSV
LERLDELLETPGDLQTLPRSQQHCVATQLLLDLENTLRDXXXXXXXXXXXXXXXXXXXLT
LELQVPGDRQVTLSQNQTKMQLTWDLAQKPGHPGPAMVGLISIPKMGKLLAEAPLVLEPG
RQLETNWGPHLTPALLSDVITAFLSHRDTQNLSSPVTFTFSHRAASAGPRRGVLCVSWLG
GRGEYGHWVTTGCETVDTGDSSTTCSCSHLSSFAVLMAHDGRQEADPALALITQVGLGLS
LLCLLLAALTFLLCRAIRNLSTTLHLQLSICLFLAHLLFLTAIHRTEPKVLCAIIAGALH
YLYLAAFTWMLLEGLHLLLAARNLTVLHSSARSRGFRALLFPVGYGLPAVVVAVAAAARP
RLYGTAARCWLNTEKGFVWAFLGPVCTIISINMVCFLLTLWAVKSRLSTLSRDVSTLRDT
RMLAFKGVAQLFILGCTWILGVLQVGAAARVLAYLFTIANSLQGVFLFLVYCLLSQQVRD
QYRRGFRRTGKSTEEPASYTLSSQAAPEAARPAP
Download sequence
Identical sequences ENSDORP00000010364 ENSDORP00000010364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]