SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010432 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010432
Domain Number 1 Region: 306-378
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000302
Family Domains B1 and B5 of PheRS-beta, PheT 0.016
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000485
Family Domains B1 and B5 of PheRS-beta, PheT 0.0091
Further Details:      
 
Domain Number 3 Region: 539-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000000745
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0046
Further Details:      
 
Domain Number 4 Region: 220-259
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000233
Family B3/B4 domain of PheRS, PheT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010432   Gene: ENSDORG00000011102   Transcript: ENSDORT00000011102
Sequence length 589
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4588:45895:106005:-1 gene:ENSDORG00000011102 transcript:ENSDORT00000011102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAQGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPNGEIQKLIVTEETGKVRPY
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEHTACELMNIYKTDNHLKHYLHIIESKPLYPVIYDSNGVVLSMPPIINGD
HSKITVNTKNVFIECTGTDFTKXXXXXXXXXXXXXXXXXXXXXVEAVEVAFPNRKSSTFP
ELAYRREMVRADLINKRVGIRETPQNLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIH
ACDIVEDAAIAYGYNNIQMALPKTYTIANQXXXXXXXXXXXXXXXXXXXXXXXXXXXCSQ
EDIADKLGLDISATKAVHISNPKTAEFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PAFFPGRCAEVFARGLSVGKLGVLHPDVITRFELTMPCSSLEINIEPFL
Download sequence
Identical sequences ENSDORP00000010432 ENSDORP00000010432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]