SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010447 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010447
Domain Number 1 Region: 32-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.51e-27
Family Hypothetical protein AT3g04780/F7O18 27 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010447   Gene: ENSDORG00000011118   Transcript: ENSDORT00000011118
Sequence length 208
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_360:48:10594:1 gene:ENSDORG00000011118 transcript:ENSDORT00000011118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHDHSSGSGCRCAAEREEPPEQRGLAYGLYRIDLERLQCLNESREGSGRGVFKPWEERA
DRSKFVESDADEELLFNIPFTGNVLKGIIIMGEDDDSHPSEMILXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELRRHE
VTICNYEASANPADHQVHQVSPQTHFIS
Download sequence
Identical sequences ENSDORP00000010447 ENSDORP00000010447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]