SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010458 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010458
Domain Number 1 Region: 246-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000237
Family SPRY domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010458   Gene: ENSDORG00000011126   Transcript: ENSDORT00000011129
Sequence length 327
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_11698:5102:14611:1 gene:ENSDORG00000011126 transcript:ENSDORT00000011129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEQNLKEIIESEYGLRFRLLTEENELSLLRLQGCKFDLNLRKAKQNQQIRFSTELEKSQ
EALQRLSCLTRENMTKLKESEARVSEQQCSLQRIITELEKECKEPASSLLQNARYNLERS
ESLLLQCLKSAHITDLSSCQIKGMSKMLAVFQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGICSVTDRKGTDASGNKV
LMSMMGTDYTWVFSFKKIYLGKQMHRVGVLDYEYGQLSFYDVTESSLIYHFSHLTFQGNI
KPVFALCTSSGDLNSDSLTVNVCGNSS
Download sequence
Identical sequences ENSDORP00000010458 ENSDORP00000010458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]