SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010461 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010461
Domain Number 1 Region: 45-199
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000116
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010461   Gene: ENSDORG00000011132   Transcript: ENSDORT00000011132
Sequence length 801
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_496:1954:104885:-1 gene:ENSDORG00000011132 transcript:ENSDORT00000011132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFRTMQRRHTTLREKGRRQATRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEE
SKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAI
LGHPAFAQGRRLALSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLR
RGARIERPHDYFCKCAQCAERQRRDAFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALEL
SNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVWSDHHR
PSLSRIKLAIKYEVKKFVAHHNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLFLA
IAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPK
QIFRVKTTQFSWTEMLIMKWVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXHATLRNASLPPEVAYFTYARDKWWPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYR
GAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIMRI
KMCLIKLCKSKAKSCENDLEMGMLNSKFRKTRYQAGMKNSENLTANNTFSKPTRYQKIMK
RLIKRYVLKAQVDRENDEVNE
Download sequence
Identical sequences ENSDORP00000010461 ENSDORP00000010461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]