SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010465 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010465
Domain Number 1 Region: 209-517
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.64e-118
Family Glutaminase 0.00000447
Further Details:      
 
Domain Number 2 Region: 543-629
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-16
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010465   Gene: ENSDORG00000011136   Transcript: ENSDORT00000011136
Sequence length 655
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1959:70804:147669:1 gene:ENSDORG00000011136 transcript:ENSDORT00000011136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLRGSATLRDLLLRPPAPVCAALRRAQPLATLCRRPRGGGRPAVGPAAAARLHPWWGG
GGRPAGPLVGSLSTSRSDILQELDRGPAPAPKDSAGETDAFGNSEGKELAAAGENKIKQG
LLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVM
LDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLA
KFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPS
GLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFS
NATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATL
ANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPN
VMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSV
INLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPF
PKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Download sequence
Identical sequences ENSDORP00000010465 ENSDORP00000010465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]