SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010468 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010468
Domain Number 1 Region: 55-157,226-369
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000611
Family FAD-linked reductases, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010468   Gene: ENSDORG00000011140   Transcript: ENSDORT00000011139
Sequence length 494
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3454:60750:69805:-1 gene:ENSDORG00000011140 transcript:ENSDORT00000011139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAARLLLAALATLFAAAEGGDAPPGKIXXXXXXXXXXXXXXXXXXXXXXXXQIDVYEK
GAVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRQRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVALHSTEGKALYQVRYESEMGNGSDFYDIVVI
ATPLHLDNSSSNFTFEGFSPPIDDAQGSFQSSVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPNFFCTLDNICPVNISANFRRKQPQEAAVWRVQSPEPLFRTQLKTLFRSYYSVQTA
EWQAHPLYGSRSSFPKFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
Download sequence
Identical sequences ENSDORP00000010468 ENSDORP00000010468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]