SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010543 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010543
Domain Number 1 Region: 5-60,158-213
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000104
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010543   Gene: ENSDORG00000011223   Transcript: ENSDORT00000011221
Sequence length 274
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1007:19752:26025:-1 gene:ENSDORG00000011223 transcript:ENSDORT00000011221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPFSHLILATGSTGPFPGKCNIFCQQAAIQAYEDMVKQVQRSQFIVVVGGGSAGVEMAA
EIKTEYPEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRLAGNGSLRVNEFLQVEGYNN
IYAIGDCADVKEPKMAYHAGLHANVVVANIVNSIKQRPLKAYKPGALTFLLTMGRNDGVG
QISGFYVGRLMVRLAKSRDLFISTSWKTMRQSPP
Download sequence
Identical sequences ENSDORP00000010543 ENSDORP00000010543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]