SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010552 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010552
Domain Number 1 Region: 28-178
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-21
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 2 Region: 347-463
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 251-369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000895
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010552   Gene: ENSDORG00000011229   Transcript: ENSDORT00000011230
Sequence length 652
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_15542:20186:22641:1 gene:ENSDORG00000011229 transcript:ENSDORT00000011230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSKSLLLLLLLGQPWMGAEAVSEAVVCVGTACYTAHWSKLSAAEAQHHCKENGGNLAT
VKSEEEARHVQQALAQLLRSKAPLGARMGKFWIGLQREKGKCMDHDLPLKGFSWVGGGED
TSYKNWHRDVRTSCISKRCVSLLLDLSLPHPSHLPKWSDSPCGTPEPGINVEGFVCKFSF
KGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFASAASVVCGDETEGKSHYFLCKEKVPN
VFSWDSSGPLCVSPKFGCNFNNGGCQQDCFEGGEGSYLCGCRPGFRLLDDLVSCASRNPC
SSNPCPEEATCVSGPQGKNYTCHCPPGYQLDSSQLGCVDVDECQDSPCAQDCVNTPGGFH
CECWVGYKPGGPEEDTCRDVDECAFDQSPCAQGCINTDGSFHCSCNEGYVLSEEDGTQCK
DVDECSDPKGNPCDTECFNTPGSFHCGCQQGEELTSNGVFCITLSVSSGSPKPPPEEDKG
DAQESTVPPSKTPSSTSASEDISKGDPEDITTRRLSLSSSVPSTSAPPEMSASSGSPQIW
TEMGVHLPTTTSHDKPTGENSLVGKDSVATQSDHGTDGQKLLLFYILGTVVAISLLLALA
LGLLIYRKRRAKREEIKEKKPQNAADSYSWVPERAESRALENQYSPTPGTDC
Download sequence
Identical sequences ENSDORP00000010552 ENSDORP00000010552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]