SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010573 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010573
Domain Number 1 Region: 327-568
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-81
Family Eukaryotic proteases 0.000052
Further Details:      
 
Domain Number 2 Region: 94-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000017
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1-94
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000222
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 4 Region: 210-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 287-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000969
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010573   Gene: ENSDORG00000011252   Transcript: ENSDORT00000011252
Sequence length 572
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3634:162594:182380:1 gene:ENSDORG00000011252 transcript:ENSDORT00000011252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHFKLVAIMGYLIRLSIESIQLEADNCVTDSLTIYDSLLPIRSTILYRICEPTRTLMSF
VSTNNLMLVTLKSPYIRRLSGIRAYFEVIPEQKCENTVSVKETTGFEGKILSPYYPSYYP
PKCKCVWKFQSPLPTFGIALKFHNYSITKKTTKGCEHGWWEINEHMYCGSYIDHQTIFRV
PSPLVHIQLQCSSRLSDKPLVVEYGSYNISQPCPVGSFRCSSGLCIPQAQRCDGVNDCFD
ESDELFCVNLKPACNSSFFRQHGTLVCDGFRDCENGQDEQNCTQSVPCTNRTFKCSNDVC
FRKQNAKCDGILDCLDGSDEDGCSCPRSSSSLQRIIGGSDSQEGAWPWQVSLHFVGSAYC
GASVISREWLLSAAHCFHGNRMSDPTPWTAHLGMYVQGNAKFVSPVRRIVVHEYYNSQTF
DYDIALLQLSIAWPETLKQLIQPICIPPTGQKVRSGEKCWVTGWGRRHEADNKGSPVLQQ
AEVELIDQTLCVSTYGIITSRMLCAGLMSGKRDACRGDSGGPLSCRRQSDGKWVLTGIVS
WGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences ENSDORP00000010573 ENSDORP00000010573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]