SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010588 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010588
Domain Number 1 Region: 285-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-44
Family SPRY domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 39-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000465
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010588   Gene: ENSDORG00000011268   Transcript: ENSDORT00000011268
Sequence length 475
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4707:77268:91408:1 gene:ENSDORG00000011268 transcript:ENSDORT00000011268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMASSSGSWLLGCLLTLFLQVSAQVSDPTGDAGGFHLTRLGDTAELPCPLALWPGSVPE
EVRWQRPSRLQRPQAVHVFRRGESRDEDLMPQYAGRTELVENAQEGSVALKIHNVSLEDR
GPYQCQIRIRNLSREGSVTLQVAAPSPGRISPSAVALAAFLPVLGLLIIAGICLIWKQKR
SKEKLLYEQAMEVENLLEDHAKEKGRLHKALKKLRSELKLKRAAANSGWRRARLHFXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECFTDGCHYWEVYVGE
KTKWILGVCSESVSRKGKVTASPANGHWLLRQSRELHYEALTSPQTSFRLKEPPKCVGIF
LDYEAGIISFYNVTDKSHIFTFSHSFSGSLRPFFEPCLHDGGKNTAPLIICSELQKSEES
IVPKSEGKSYANGDVKVNPSLLPTQGPELFPLKDTIVSWHSDLGPALQGLKAPSF
Download sequence
Identical sequences ENSDORP00000010588 ENSDORP00000010588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]