SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010633 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010633
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-39
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 3 Region: 782-958
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 351-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.23e-34
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 5 Region: 965-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-30
Family Laminin G-like module 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010633
Domain Number - Region: 575-623
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000628
Family Fibrinogen C-terminal domain-like 0.0088
Further Details:      
 
Domain Number - Region: 550-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010633   Gene: ENSDORG00000011311   Transcript: ENSDORT00000011313
Sequence length 1305
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4164:17084:468027:1 gene:ENSDORG00000011311 transcript:ENSDORT00000011313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTARLTSVLTLLFSGLWQLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTPISAQLNW
RVGTGGWSPADSSAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVVHHKLLHSVRARFIRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQNGRLAL
YLNLDDSKARLSSSPPLATLGSLLDDQHWHSVLIERVGKQVNFTVDKHTEHFRTKGEADA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGINIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFVNSSSSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSEGSGTLLLSL
EGGILRLAIQKTTQHVAEILTGSSLNDGLWHSVSINARRSRIIFTLDNDLASLAQDTARV
QIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDSXMPNYCHGGRCSQSWTTFYCNCSDTGYTGGTCHDSIYEQSCEVYRHQGNTA
GFFYVDPDGTGPLGPLQVYCNITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPFTWWIGRANERHPYWGGSLPGVQQCE
CGLEENCLDFGHFCNCDADKDEWTSDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGPL
RCYGDRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGMKDFIRLE
MSSPFEIMFAIDVGNGPVELIVQSPSLLNDNQWHYIRAERNLKETSLQVDSLPRSTRQTS
EDGHFRLQLNSQLFVGGTSSRQKGFVGCIRSLHLNGQKLDLEEKAKVTSGVRPGCPGHCS
SYGSNCHNGGKCVEKHSGYSCDCTNSPYEGPFCQKEVSAVFEASASITYMFQEPYPVTKN
MSLSSSSIYTDVTPSKEIIALSFVTAQAPSLLLFINSSSQDFLALYICKNGNLQVRYQLG
KEESYVFTIDAENFANRRMHHVKISREGRELTIQMDQQFRLSYNFSPEAEFRPVRSLTLG
KITENVGLDSEIAKANTLGFVGCLSSVQYNHIAPLKAALRHTTIAPVTVQGTLTESSCGA
MVDSDVNAVTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFITFCIIGIMTRF
LYQQKQTHRTNQMKEKEYPDNLDSSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences ENSDORP00000010633 ENSDORP00000010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]