SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010654 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010654
Domain Number 1 Region: 149-244
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-37
Family Link domain 0.00078
Further Details:      
 
Domain Number 2 Region: 255-338
Classification Level Classification E-value
Superfamily C-type lectin-like 2.68e-22
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 44-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000244
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010654   Gene: ENSDORG00000011334   Transcript: ENSDORT00000011334
Sequence length 340
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4450:32944:35493:1 gene:ENSDORG00000011334 transcript:ENSDORT00000011334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGQLTLPARCCFLLPWALTIFHTALGTPAPHPDPHYLLSPIHEVIHSRRGATATLPCVL
CASPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGDRARMRRHRLDASLVIAGVRL
EDEGRYRCELINXXXXXXXXXXXXXXXVVFPYQPSRGRYRFNYFEAKQACEEQDGRLATY
GQLYQAWTDGLDWCNAGWLLDGSVRYPVLTARAPCGGRGRPGIRSYGPRDRKRDRYDAFC
FTSALAGHVFFVPGRLTLPEAHEACRRRGAAVAKVGHLYAAWKFSGLDQCDGGWLADGSV
RFPITTPRPRCGGLPDPGVRSFGFPQPQQAAYGTYCYAEK
Download sequence
Identical sequences ENSDORP00000010654 ENSDORP00000010654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]