SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010679 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010679
Domain Number 1 Region: 257-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-29
Family SPRY domain 0.00075
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 1.81e-18
Family RING finger domain, C3HC4 0.006
Further Details:      
 
Domain Number 3 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000885
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010679   Gene: ENSDORG00000011361   Transcript: ENSDORT00000011361
Sequence length 415
Comment pep:novel scaffold:dipOrd1:scaffold_3681:81036:82359:-1 gene:ENSDORG00000011361 transcript:ENSDORT00000011361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDIAQAFQKEVSCAICMNTFIEPVTLECGHSFCRPCLCLCWEETQIPARCPGCRGPCQ
QRNLKTNVVLRSLVAIARRASLRRFLRSEEYMCGTHRETKQMFCEVDRALLCRSCSQSQE
HRAHQHHLIERVAEEQREVISKRMDTVWEKTQENQRNLHKKRRMTQDAFTMLQLGIREEE
RQHSQLLINEGRAMLLQLRKGNKMLQKKHQLRKTYQELMETYQKPDVELLQESVLVFMPL
PLKPRLSAPPMPGLIERLSQYRVEISFNEAVGNFMGAVLDRTIYAVLNSEESLLFTAFGH
PVFSSGKHYWEVSVDDSSTWALGVVRDSAIGSNLTEYEDVFLLLIVKENTLYTLFTTSPL
MPHYVEKPLGWVGVFLDLDHGSVSFWNVAKSSLIWRYPTGSLQFPVRPLFSRGYR
Download sequence
Identical sequences ENSDORP00000010679 ENSDORP00000010679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]