SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010775 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010775
Domain Number 1 Region: 4-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-45
Family GDI-like N domain 0.00000000139
Further Details:      
 
Domain Number 2 Region: 441-552
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.24e-20
Family GDI-like 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010775   Gene: ENSDORG00000011463   Transcript: ENSDORT00000011463
Sequence length 604
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6234:3554:93458:-1 gene:ENSDORG00000011463 transcript:ENSDORT00000011463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSEFDVIVMGTGLPESIIAAACSRSGQRVLHVDSXXXXXXXXXXXXXXXXXXXXX
XXXEESDTVTESSWQEHILDSEEAIELNRKDKTIQHVEVFYFASQDSNEDVEEAGALQKN
HSSVASANFTEAVSSLCQPTEDDSLNAAGCGVALESTPSSDPESAQEVNDAQVAGEKENH
SDDKTSPEETSENVPIVEDIAEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLL
IKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLSMVEKRMLMKFLTFCMEYE
EHPDKYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMSSESSSSTTDLKATKNFLHCLGR
YGNTPFLFPLYGQGELPQCFCXXXXXXXXXXXXXXXXXXXXXXXXXXXCKAIIDQFGQRI
ISKHFIVEDSYFSENTCCRVQYRQISRAVLITDRSVLKTDSDQQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLVHLTCTSSKTAREDLEPVVQKLFGPYEEPELEHEEIEKPRIL
WALYFNMRDSSDISRNCYNDLPSNVYVCSGPDCGLGNDKAVKQAETLFQQICPNEDFCPP
PPNP
Download sequence
Identical sequences ENSDORP00000010775 ENSDORP00000010775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]