SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010777 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010777
Domain Number 1 Region: 44-141,175-210,293-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000265
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010777   Gene: ENSDORG00000011465   Transcript: ENSDORT00000011465
Sequence length 450
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1348:45226:72622:1 gene:ENSDORG00000011465 transcript:ENSDORT00000011465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLASVVFSPRARLFAHFLRLGTQQAGPLQLHTGACCAAKNYYEVLVLGGGSGGITMAS
RMKRKVGAENVAIIEPSERHFYQPIWTLVGAGAKQLSLSGRPTASVIPSGVEWIKATVVE
LNPDKNCVYMDNNKEXXXXXXXXXXXXXXXXXXIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAVFTFPNTPVKCAGAPQKIMYLAEAYFRKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEMLHVTPPMSS
PDVLKRSPVADAAGWVDVDKDTLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SQIMKNQTPKKKYDGYTSCPLVTGYNRVILAEFDYRAQPMETFPFDQSKERLSMFFMKAD
LMPFLYWNVMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences ENSDORP00000010777 ENSDORP00000010777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]