SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010789 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010789
Domain Number 1 Region: 1518-1689
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-69
Family Endostatin 0.0000000641
Further Details:      
 
Domain Number 2 Region: 450-630
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-29
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 313-429
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.28e-28
Family Frizzled cysteine-rich domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010789   Gene: ENSDORG00000011477   Transcript: ENSDORT00000011478
Sequence length 1695
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5882:452:57902:1 gene:ENSDORG00000011477 transcript:ENSDORT00000011478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDPSGRLCLLLPCCCPASAGANLLSLEWLWSSALRLPCHPGPPTHAGPRHDPTEPAPL
SASPELPREHQGPGRPGPSAPPTAPATPAASPDTKEENIAGVGAKILNVAEGIRSFVQLW
DDATPTPNSAVADPPTHTGLSSNPQESRTILWPSSGALGSPDTQSPEASTLAAPTQPSPS
WSRTQAPQWGSTAPPVPTGRAPLSSIPGRAPAWSLHLDRGRRLPVAAGPSPRHGCPEARM
LTPLLLPLVVGPLATRSASSAPPSAPSARLAQVAAPAPCGDRGAWFSHGAGSPVPGLANN
AALLGAAPQAPAGRCLPLPPGLPVCSHLGFGHSWLPNLLHHKSSEEVRAAARAWTGLLRT
HCHPFLAWFFCLLLAPPCGPGPGPPPALPPCRQFCKVLEDACWSGLEGAGLPISCASLPD
QEEGYCVFIGPAAESAVEEVGLLQLLREPLPPQITPIEDPDVGPAYDFGPGANSGQGAQS
HFPRLFFRDFSLLFHIRPATAGPGVLLAITDAAQALVSLGVKLSEVQGGYQNVSLLYTEP
GAAQTHVAASFRLPALVGRWTRFALSVDGGTVALYLDCDEFQRVPFARSLPGLELEHGAG
LFLGQAGGADADKFQGAIAELRVRGDPKVNLGHCLDEEDDDEDGASGDFGSGLEDGHRPH
GEDTDTPLQPGLPLPSPASLPPLAGGSPMESSRTEETEDEIMVDSFGAPTLPDSESAGVW
DRGVQSPEGGLETGVLSRQKEESGVPGPPSGAGLPSTCPVAQGPPGPPGPPGKDGSPGQD
GKPVSTPVPTGLGDAGPQGFPGTPGDVGPKGEKGDPGVGPRGPPGPQGPPGPPGPPFRQD
KLTFIDMEGSGFSGDLEPLRGPRGFPGPPGPPGVPGLPGEPGHFGVNSSHVPGPAGLPGV
PGRDGRPGPPGVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSKGDPGPMGAPGESGS
AGSPGTPGPRGPPGPPGPPGPGVPAGFDDMEASGMLLWSTARGAAGPQGLPGVPGLPGDP
GAMGPPGAKGEAGADGARGFPGLPGREGSAGPLXXXXXXXXXXXXGDPGKDGVGQPGLPG
PPGPPGPVVYVSDQDGPTGPKGDLGSKGEQGLPGPKGEKGEPGGFYGADGRALGPAQKGA
KGEPGFRGPPXXXXXXXXXXXXXXXXXXGRPGVNGLKGEKGEPGDTSLGLGMRGMPGPPG
PPGPPGPPGVPVYDSNAFMEAGRPGPKGLQEAQGPSGPKGDKGEVGPPGPPGQFPLDLLH
LEAEMKGEKGDRGDAGQKGERGEPGPSGGFFGSSVPGPPGPPGPPGYPGIPGPKGESIRG
QPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTVSVPGPPGPPGPPGPPGAMG
ASSGVRIWATYRTMLDRVREVPEGWLIFVTEREELYVRVRNGFRKVLLGAQTSLPPASGN
EVAAVQPPVVQLHEGGPYARREHTHATERPWRADGVLAVPPRLPDPQAYPGVPHHSSYMH
LRPAHPTSSPAHTHQDFQPVLHLIALNSPLPGGMRGIRGADLQCFQQARAAGLPGTFRAF
LSSRLQDLYSIVRRADRGAVPIVNLKDEVLAPSWEALFSGSQGQLQPGARIFSFDGRDVL
RHPSWPQKSVWHGSDPNGRRLTESYCETWRTEASSAAGQASSLLAGRLLEQKAAGCHNPY
VVLCIENSFMTSASK
Download sequence
Identical sequences ENSDORP00000010789 ENSDORP00000010789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]