SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010791 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010791
Domain Number 1 Region: 101-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-52
Family Lectin leg-like 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010791   Gene: ENSDORG00000011482   Transcript: ENSDORT00000011482
Sequence length 358
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6729:20501:49816:-1 gene:ENSDORG00000011482 transcript:ENSDORT00000011482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAILGLSWLQRWRRRLLARDVSKILLLLLLVGSGQGPRQVGAGQTFEYLKREHSLSKPY
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCFLRDWELQVHFKIHGQG
KKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFIDTYPNEEKQQEAQKRRYSPGVQR
VFPYISTMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTVMMDIDG
KHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVF
LPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
Download sequence
Identical sequences ENSDORP00000010791 ENSDORP00000010791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]