SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010794 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010794
Domain Number 1 Region: 150-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-30
Family SPRY domain 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010794
Domain Number - Region: 45-69
Classification Level Classification E-value
Superfamily BSD domain-like 0.068
Family BSD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010794   Gene: ENSDORG00000011486   Transcript: ENSDORT00000011485
Sequence length 279
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6855:685:5725:1 gene:ENSDORG00000011486 transcript:ENSDORT00000011485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYVTMHKVITSDIYEMLHPNFQEERKQYSEILTNEETVVLQQLKKREAQMLQKKKDLRKL
YQELVKTYQKPDVELLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEF
FFGHETQNINMMFDHVQMFGPTCAVSFLNFDGINYFAVSGAQIFCSGKHYWELSVDDSLD
WAVGIYRNCKTMNEPVIIDPEDVFLLLCVKDDIGYSIFTTSPMLRHYIEKPLGKIGIFLD
LENGSVSFLNVAKSSLIWRYPTSSFHFPVRAFYSTGHKL
Download sequence
Identical sequences ENSDORP00000010794 ENSDORP00000010794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]