SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010826 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010826
Domain Number 1 Region: 1874-2118
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.21e-53
Family Ankyrin repeat 0.0000000615
Further Details:      
 
Domain Number 2 Region: 1172-1314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 3 Region: 412-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000318
Family EGF-type module 0.00034
Further Details:      
 
Domain Number 4 Region: 755-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000641
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 5 Region: 529-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000774
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 909-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000875
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 993-1103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000132
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 8 Region: 792-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000137
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000171
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 630-749
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 604-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000042
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 12 Region: 871-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000658
Family EGF-type module 0.006
Further Details:      
 
Domain Number 13 Region: 566-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 14 Region: 1147-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 296-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000418
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 16 Region: 178-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 17 Region: 258-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.016
Further Details:      
 
Domain Number 18 Region: 220-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 19 Region: 1310-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000714
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 333-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000929
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 21 Region: 453-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 22 Region: 61-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 105-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000378
Family EGF-type module 0.031
Further Details:      
 
Domain Number 24 Region: 1112-1151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000911
Family EGF-type module 0.032
Further Details:      
 
Domain Number 25 Region: 375-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000119
Family EGF-type module 0.038
Further Details:      
 
Domain Number 26 Region: 1393-1430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.019
Further Details:      
 
Domain Number 27 Region: 1347-1387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000738
Family EGF-type module 0.015
Further Details:      
 
Domain Number 28 Region: 832-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010826
Domain Number - Region: 26-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00225
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 947-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0472
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010826   Gene: ENSDORG00000011518   Transcript: ENSDORT00000011520
Sequence length 2546
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6314:14108:59998:-1 gene:ENSDORG00000011518 transcript:ENSDORT00000011520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPRAPLLCLALLLPALAARGLRCSQPGGTCLNGGKCEVVNGTEACVCGGAFVGQRCQD
PNPCLSTPCKNSGTCHLVDRGGTVDYACSCPLGFSGPLCLTPLDNACLTYPCRNGGTCDL
LRLTEYKCRCPPGWSGKSCQQADPCASNPCANNGQCLPFEASYICRCPPGFHGATCRQDV
NECSQNPELCRHGGTCHNDVGSYHCTCRATHRGTHCELPYVPCSPSPCQNGGTCRPTGDA
THECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDEC
QLMPNACQNGGTCHNTLGSYSCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNKGSNCDTNPVNGKAICTCPPGYTGPACSQDVDECALG
ANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSGHLCQYDVDECASTPCRN
GARCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVSTFTCLCQPGYTGHH
CETNINECHSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASNPCQAGTCLDKI
DGYECVCEPGYTGSMCNINIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNE
CNSNPCIHGACRDSLNGYKCDCDPGXXXXXXDVNNNECESNPCVNGGTCKDMTSGYVCTC
RGGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCTPSPCK
NSGVCKESEDYESFSCVCPPGCPTGQTCEVDINECVKSPCRNGASCQNTNGGYRCLCQAG
YTGLNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCHNGA
NCTDCVXXXXXXXXXXXXXXXXXXXXXXXXXXSCFNGGTCVDGINSFTCLCPPGFTGSYC
QYDLNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGQCWQTN
TLYRCQCHSGWTGFYCDVPSVSCEVAAQEQGVDVAHLCQHGGLCVDANNTHHCRCQAGYT
GSYCEEEVDECSPNPCQNGATCTDYLGGYSCKCVAGYHGANCSEEINECLSHPCQNGGTC
IDLTNTYKCSCPRGTQGVHCEINVDDCNPLLDPTSRSPKCFNNGTCVDQVGGYTCTCPPG
FVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKN
GGTCAVAANIARGFICRCPAGFEGATCENDARSCGSLRCLNGGTCISGPRSPTCLCLDPF
TGPECQFPASSPCVGGNPCYNQGSCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGVGR
DIPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIVYL
EIDNRQCVQSSTQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPSQLHLMY
VAVAAFVLLCFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLK
HASDGALMDDNQNEWGDEDLETKKFRFEGPVVLPDLDDQTDHRQWTQQHLDAADLRTSAT
APTPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGA
SLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQ
ILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAV
NNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSHETAKVLLDHFANRDITDHMDRLPR
DIAQERMHHDIVRLLDEYNLVRSPQLHGSALGGTPTLSPTLCSPNGYLGNLKPTTQGKKA
RKPSTKGLACGAKEPKDLKARRKKSQDGKGCLLDSSSMLSPVGSLESPHGYLSDVASPPL
LPSPFQQSPSMPLNHLPGMPDVHMAISHLNVATKPEVAALSGGGPLAFEPGPPRLSHLPV
ASTPSTVLGASGGAAVNFTVGTSTSLNGQCEWLSRLQNGMVPNQYNPLRAGVVPGALGTQ
APALQHGMLGSLHGGLSANTLSQIMGYQGLPNTRLAAQPHLVQTQPVPQPNLPPPNIPQP
QNLQPPTQPHLGSATNGPLGRSFLSGESSQVDVQPLGPSSLPVHTVLPQEPQALSTSLPS
SLVPPMTTAQFLTPPSQHSYSSSPADNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNI
SDWSEGISSPPTSMQSQIAHIPEAFK
Download sequence
Identical sequences ENSDORP00000010826 ENSDORP00000010826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]