SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010834 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010834
Domain Number 1 Region: 502-628
Classification Level Classification E-value
Superfamily TIMP-like 1.31e-27
Family Netrin-like domain (NTR/C345C module) 0.056
Further Details:      
 
Domain Number 2 Region: 332-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000053
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010834
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.034
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010834   Gene: ENSDORG00000011529   Transcript: ENSDORT00000011529
Sequence length 628
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1562:170490:392099:-1 gene:ENSDORG00000011529 transcript:ENSDORT00000011529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRARLLLLWLSSAVAAGLNGVAGASFRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENVDLTCRQPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSRYSNPFPCTGGEVIFRALSPPYDVENPYSAKVQEQLKITNLRVQLLKRQSCPCHRND
LNTKPQHFTHYAIYDFIVKGSCFCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKCNGHADTCHFDISVWEASGNRSGGVCH
NCQHNTEGQHCQRCKPGFYRDLRRPFSAPDACKVCSCHPVGSAILPFSSVTFCDPSNGDC
PCKPGVAGPHCDRCMVGYWGFGDYGCRPCDCAGSCDPLTGDCISSNTDLDWYQEIPNFQS
IHNKSEPTWEWEDEQGFSALRHSGKCECKEQVLGNSKAFCGMKYSYVLKIKILSAHDKGS
HAEVNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKL
IVNMKSFVQLWKPSLGRKVMDILKRECK
Download sequence
Identical sequences ENSDORP00000010834 ENSDORP00000010834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]