SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010846 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010846
Domain Number 1 Region: 225-542
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.33e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000556
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010846
Domain Number - Region: 118-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000343
Family Anticodon-binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010846   Gene: ENSDORG00000011542   Transcript: ENSDORT00000011542
Sequence length 548
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2897:5598:25632:-1 gene:ENSDORG00000011542 transcript:ENSDORT00000011542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEPKCVKINAL
EAYRGQRVKVFGWVHRLRRQXXXXXXXXXXXXXXXXXXXXXXXXCHCYNGVVLSTESSVA
VYGMLKLTPKGKQAPGGHELSCDFWELVGLAPAGGADNLINEESDVDVQLNNRHMLIRGE
NVSKILKARSVITRCFRDHFFDRGYCEVTPPTLVQTQVEGGSTLFKLDYFGEEAFLTQSS
QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLVCD
VVDRVLKSPIASIVHELNPNFMPPKRPFRRMNYSDAIVWLKEHNVTKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVQIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIW
DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP
RFVQRCKP
Download sequence
Identical sequences ENSDORP00000010846 ENSDORP00000010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]