SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010853 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010853
Domain Number 1 Region: 437-539
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000000000398
Family Biotin holoenzyme synthetase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010853   Gene: ENSDORG00000011550   Transcript: ENSDORT00000011549
Sequence length 709
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4383:64992:109132:-1 gene:ENSDORG00000011550 transcript:ENSDORT00000011549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRLQMDNGLIPQKIVSVHLHDSTLKELKDQAARGQVQSLKLAARPSPEPKPVQHADRD
EPRAPGQDSCKQRTDGEGEPEEHSHLHLFSCHECLELENSTIESVKFASAENIPDLPYDH
SSGLEAVTDELCPKREESRVNMVGKAPNILVYVGPGTQDTLGRLEQVRSVLADCVDADSY
TIYHLPEDSGLRDPWADNCILLVIAALEPIPKDLYQKFMAYLSQGGKVLALSSSFTFGGF
QVTGEGMLRKTVQDLVXXXXXXXXXXXXXXXXXXXXXXXXXQLSWAHGHLDTEDKDRTIL
QVPFGSCGGEAVLCQVHLELPPSSPTVQTQEDFNLLKSSNMKRYEVLREILTTLGISCDV
RQVPALTPVSLLLATEEIRDPLMQWLGAHVDPKGVIKSSKLSLKFVSSCASEVEVTPSSI
PVITDTEDFSSEHFNLDIYRQNLQTKQLGKVILFAEVTPTTMNLLDGLMFEMPQEMGLIA
IAVRQTQGGRGPNAWLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSLAVVEAVRSTPK
YQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQQVRLGS
TEGPQVSIVGLDDSGFLQVHQEDGRIVTVHPDGNSFDMLRNLIVPKQRW
Download sequence
Identical sequences ENSDORP00000010853 ENSDORP00000010853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]