SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010903 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010903
Domain Number 1 Region: 55-109,143-251
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000154
Family beta-glycanases 0.073
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010903
Domain Number - Region: 304-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0126
Family Family 1 of glycosyl hydrolase 0.099
Further Details:      
 
Domain Number - Region: 552-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0435
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010903   Gene: ENSDORG00000011603   Transcript: ENSDORT00000011603
Sequence length 685
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_335:7592:45658:-1 gene:ENSDORG00000011603 transcript:ENSDORT00000011603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSPREASRQRRIQDMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGLEFDGIGA
ISGGGATSRLLVSYPEPFRSEILDYLFKPNFGASLHILKVEIGGDGQTTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLPWSFPGWLGKGLNWPYKNIQLTAYYIVSWIV
GAKHYHNLDIDYIGIWNERSFDVNYIKVLRRMLNYQGFQQVKIIASDNLWEPISSSMLFD
PELLKVIDVIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTIAWNLVASYYEELPYGRCGLMTAQEPWSGHYVVESPIWVSAHTSQFTQPGWYYLKT
VGHLKQGGSYVALTDGLGNLTIIIETMSHKHSMCIRPFLPYYNVSQQLATFFLQGTLSDI
PELQVWYTKLGIPSERFLFKRLDSIWLLDSGGTFTLELQEDEIFTLTTLTTGRKGQFPFP
PKSRPFPSIYDDDFNVEYPFFSEAPFFADQTGVFEYYMNTEDPGEHQFTLRQVLNQRPIT
WAADAFSPISIIGDYQWTNLTIECDVYIETPEKGGVFIAGRVNKGGILIRSATGVFFWIF
ASGFYRLTADLAGWMMYTSGHAEIRAQEWYTLTLIIKGPLSSGMLNGQFLWKNVPVHYPR
NGWAAIGTHSFEFAQFDNFHVEAEH
Download sequence
Identical sequences ENSDORP00000010903 ENSDORP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]