SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010919 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010919
Domain Number 1 Region: 724-833
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-45
Family Thrombospondin C-terminal domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-34
Family TSP type-3 repeat 0.00000379
Further Details:      
 
Domain Number 3 Region: 515-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 9.02e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 890-938
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000601
Family Thrombospondin C-terminal domain 0.0015
Further Details:      
 
Domain Number 6 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000772
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 7 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 53-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000617
Family Laminin G-like module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010919
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 416-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 278-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010919   Gene: ENSDORG00000011619   Transcript: ENSDORT00000011619
Sequence length 955
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5167:72777:83467:-1 gene:ENSDORG00000011619 transcript:ENSDORT00000011619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALELRGALAXXXXXXXXXXXXXXXXIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPGLQLYVDCKLGDQYAGLPALAPIPPAEVSGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVANALQSILGEQTKALVTQLTIFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCDDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PTHSPCHVHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAFLFSYQDSGRFYVVMWKQTEQTYWSGTPFRAVAQPDLQLKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKLYEGPQLV
ADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences ENSDORP00000010919 ENSDORP00000010919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]