SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010937 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010937
Domain Number 1 Region: 180-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.48e-47
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000207
Further Details:      
 
Domain Number 2 Region: 491-630
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.36e-26
Family Ricin B-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010937   Gene: ENSDORG00000011640   Transcript: ENSDORT00000011638
Sequence length 639
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2711:4315:32280:1 gene:ENSDORG00000011640 transcript:ENSDORT00000011638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRKRQRQGPCRLPFRLLLVMLGCLLMMVVMLYPPPPTLPQDATARTSKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CLQQHPEGSLPTASVILCFHNEAWATLLRTVHSVLDTAPRALLTELILVDDFSQQEQLKS
ALSEYVTRLEGVKLIRSNKRLGTIKAQMLGANRATGDVLVFMNARCECHSGWLEPLLSRI
AGDRNRVVSPLIDVIDWKTFQYYPAQELQRGVLDWKLELHWEPLSEREKKARPSPISPVR
SPVVLGEVVAVDRYYFQNTGAYDPLMALQGGENLELSLKAWLCGGSVEVIPCSRVGHLYP
NQDTRTSLDKKAVLMNKVRLAEIWLGSFKETFYRHSPDAFTLSKAVSLDFRERIKLQRTL
GCRTFHWFLANIYPELYPTEPRPRFTGKLRNKGLGFCADCRAEGDTLGCPVVLVSCSNRR
QQQRLEHIGRKEIRFGSPPHLCFDVKQEQVILQDCIQESSAIHSQLWDFQKNGMLVHIVS
GKCVEAVDEQSSMDLFLSPCQDKASQLWRFDQVHPVDER
Download sequence
Identical sequences ENSDORP00000010937 ENSDORP00000010937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]