SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010945 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010945
Domain Number 1 Region: 334-465
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.79e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 1-141,259-327
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.7e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000196
Further Details:      
 
Domain Number 3 Region: 144-202
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000225
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010945   Gene: ENSDORG00000011646   Transcript: ENSDORT00000011646
Sequence length 466
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5990:11058:73571:-1 gene:ENSDORG00000011646 transcript:ENSDORT00000011646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQLGKKVAVVDYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGVIRDAQHYGWDVG
QPIQHDWKKMAEAVQNYVKSLNWGHRVQLQDXXXXXXXXXXXXXXXXXXXXXXXXXXXTL
LSAEHIVIATGGRPKYPTHIAGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLT
GIGLDTTVMMRSVPLRGFDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRVPETRGLNLEKAGVNTNPETQKILVDSREATSVPHIYAIG
DVAEGRPELTPTAIMAGKLLAQRLFGQSSDLMDYSNVPTTVFTPLEYGCVGLSEEEAVAC
HGQEHIEVYHAFYKPLEFTVAERDASHCYIKMVCLRKPPQLVLGLHFLGPNAGEVTQGFA
LGIKCGASRAQVMRTVGIHPTCAEEVVKLHITKRSGLDPTVTGCUG
Download sequence
Identical sequences ENSDORP00000010945 ENSDORP00000010945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]