SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010969 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010969
Domain Number 1 Region: 199-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 2 Region: 100-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000879
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 4 Region: 53-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000578
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010969
Domain Number - Region: 164-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010969   Gene: ENSDORG00000011670   Transcript: ENSDORT00000011670
Sequence length 401
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1506:12664:52074:-1 gene:ENSDORG00000011670 transcript:ENSDORT00000011670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMCNCSRVGSLDVKRCNQTTGQCECKSGYEGLHCEACEKGFYLNHTSGLCLPCHCSPHGA
LSILCNSSGNCQCRVGITGSTCNRCQDGYYGFSKNGCLPCHCNNRSASCDALTGACLNCQ
KNSKGDHCEECKEGFYQSPDVTKGCLRCPCSAVTSTGNCTIKLDELEPTCVQCKDGYTGK
NCNTCGNGYYNSDSICMPCQCHGHVDSIKTPKICKPESGECINCLHNTTGFWCENCLEGY
VRDLQRNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINITFTPTTLQTTFSVSSSENS
TSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNIS
FSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSDORP00000010969 ENSDORP00000010969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]