SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010996 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010996
Domain Number 1 Region: 192-458
Classification Level Classification E-value
Superfamily vWA-like 1.81e-50
Family Integrin A (or I) domain 0.00002
Further Details:      
 
Domain Number 2 Region: 570-748
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.02e-23
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 3 Region: 88-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 154-210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 5 Region: 24-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000577
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010996
Domain Number - Region: 462-504
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0244
Family Eukaryotic proteases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010996   Gene: ENSDORG00000011697   Transcript: ENSDORT00000011698
Sequence length 755
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6608:1583:14269:1 gene:ENSDORG00000011697 transcript:ENSDORT00000011698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLLTFLCLLLLCPGLVAAAAPSCSQNVNISGGTFTLSHGWAPGSLLIYSCPQGSYPSP
ATRLCKSNGRWQTPGSIRRSARLVKAVCKPVRCPAPVTFENGVYTPRLGSYPVGGNLTFE
CEDGFTLRGSPVRHCRPNGMWDGETAVCDNGADHCPNPGTSVGAVRTGSRFDLGYKVSYR
CSSNLVLTGSAERECQSNGVWSGTEPICRQPYSYDFPEDVAPALGTSLSHLLGATNPNQK
RKEKLARRIQIQRSGHLNLYLLLDASQSVSEENFKIFRDSASLMVDRIFSFDININVAII
TFASRPKIIMSVLNDKSQDMTEVATSLENLNYQDHENGTGTNIYEALNSVYIMMNNQMQR
LGIGTVAWQEIRHAIILLTDGKSNIGGSPKPAIDNIIELLKIKPDRNDYLDIYAIGVGKL
DVDWKELNELGSKKDGERHAFILQDTQALQQVFEHMLDVSKLTDTICGVGNMSANASDQE
RTPWHVTFKPKHQETCRGTLISDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLAQRVKMSSHARPICLPCTMEANMALRKPQ
GSTCQDHEKELLNQQSIPAHFVALNGNKLNINLKTGKQRTSCIQVVSQDKKTFPNLTDVT
QVVTDQFLCSGMPGDANICKGESGGAVFLERRFRFFQVGVVSWGLYNPCSGTTNKNTRKK
APPGVPPPRDFHINLFRLQPWLREHLEGVLNFLPL
Download sequence
Identical sequences ENSDORP00000010996 ENSDORP00000010996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]