SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011018 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011018
Domain Number 1 Region: 148-348
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.44e-45
Family Ankyrin repeat 0.00047
Further Details:      
 
Domain Number 2 Region: 372-560
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-41
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 24-112
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-20
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011018   Gene: ENSDORG00000011718   Transcript: ENSDORT00000011720
Sequence length 1083
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1355:6311:49094:-1 gene:ENSDORG00000011718 transcript:ENSDORT00000011720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDCERSVYKLHKCMRNLRKSNKDEDENVSPLHHAAAEGQVELMKMIISGSSCDVLNAMDD
YGNTPLHWAAENNQVGSVKFLLCQGANPNLRNSNMMAPLHIAVQGTYNEITKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLSKGAKLCKSNKWGDYPVHQAAFSGAKKCMEL
ILKFGEESGYTRESHINFVNNKKVSPLHLAVQSGDLEMIKMCLDNGAHIDLQENGKCMAL
HFAATQGATEIVKMMISSYSGNNDIVNAVDGNHETLLHRASLFDHHELADYLISVGADIN
TTDSEGRSPLILATASASWNIVNLLLSKGAKVDIKDHLGRNFLHLTVQQPYGLKNLQPEF
MQMQHIKELVMDEDNEGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASY
GRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWT
ALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVALLLNHDADIVM
NKQQASFLHIALHNKRKEVVLTTIRSKRWDECLKVFTHHSPSNRCPIMEMVEYLPECMKI
LLDFCMIPSTEDKSCRDYHIEYNFKYLQCPLTFTKKITPTQEVVYEPLSILNXXXXXXXX
XXXXXXXXXXXXXXXXCAYGFRAHMMNLGSYCLGLIPMTLLVVHIKPGMAFNSTGIFNES
SDHLEILDTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRNYFLDYNNALEWIIYTTS
IIFVLPLFVSIPGHVQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTG
VFIFLLLAFGLSFYVLLNLQDAFSSPLLSLIQTFSMMLGDINYRDAFLEPFLRKELAYPV
LSFAQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPVWFL
RKVDHKSTIVYPNRPRHGKILRLFNYFFGTQETRQEIPNTDACLEMEILKQKYRLKDLSS
LLEKQHELIKLIIQKMEIISETEDEDNHCSFQDSFKKERLEQMNSKWNFVLRAVKTKTHS
PKH
Download sequence
Identical sequences ENSDORP00000011018 ENSDORP00000011018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]