SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011024 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011024
Domain Number 1 Region: 179-576,657-662
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-56
Family FAD-linked reductases, N-terminal domain 0.0000000000239
Further Details:      
 
Domain Number 2 Region: 561-669
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.5e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011024   Gene: ENSDORG00000011724   Transcript: ENSDORT00000011726
Sequence length 755
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_17:4890:38582:1 gene:ENSDORG00000011724 transcript:ENSDORT00000011726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGR
LQDDSGGYGDGQASGVEGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
QLWLDNPKIQLTFEATLQQLEAPYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKT
GKVIIIGSGVSGLAAARQLQSFGMDVTLLEARXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GNPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLSH
QLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEK
IKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKXXXXXXXXXXXXXXXXXXXXXX
XXXDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCV
PVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQP
PAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLF
WNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRAD
PWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXKIADQFLRAMYLPRATPGPAQQSPNM
Download sequence
Identical sequences ENSDORP00000011024 ENSDORP00000011024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]