SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011061 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011061
Domain Number 1 Region: 532-613
Classification Level Classification E-value
Superfamily E set domains 4.04e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000041
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011061
Domain Number - Region: 1087-1138
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00101
Family Motor proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011061   Gene: ENSDORG00000011763   Transcript: ENSDORT00000011766
Sequence length 1198
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6038:42669:63057:-1 gene:ENSDORG00000011763 transcript:ENSDORT00000011766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEW
LSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMECLYGCYV
HSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLKWSREE
LLGQLKPMFHGIKWSCGNGTEEFSVEQLVQQILDTHPTKPAPRTHACLCSGGLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSSSSG
FAEPLEIRPSPPTSQGSRGGTAILLLTGLEQRARGLTPTRHLAPQAENRPSVSLAVVVGS
EPTAPPAPPSPAFDPDRFLNSPQRGQTYGGGHGVSPDFPEAEAAHTPCPALEPAAALEPQ
AATRGLPPQAGAGGKRGNCFFIQDDDGREELKSQGVAPPVPSPPPSSPSSPAPLEPSGRV
VRGEALFGGPGGANELEPFSLSSFPDLMGELISEEASSIPSSTPQLSPALSTITDFSPEW
SYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVAGR
EGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRMAEIAAAGQAP
CQGPEAPLIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSSVSSP
SELSDGTFSITSAYSSAPDGSPPTAPPPASEVTMEEMVSGPLSSGAPETPLLMDYEATNP
KGSSPSPPAFLPAPDDGAAPEDADSPSAVDVIPVDMISLAKQIIEATPERIKREDFVGLP
EAGTSMRERTGAVGLSETMSWLASYLENVDHFPSSAPPSELSFERGRLTMPPAPSWAEFL
SASTSGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVAAAVIQRCYR
KYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQHYRSYRRRPG
PHRPSGPLPARNKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQELEGLPQPGLAT
Download sequence
Identical sequences ENSDORP00000011061 ENSDORP00000011061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]