SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011081 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011081
Domain Number 1 Region: 143-396
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.28e-45
Family Ankyrin repeat 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011081   Gene: ENSDORG00000011790   Transcript: ENSDORT00000011788
Sequence length 519
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3746:7588:22337:1 gene:ENSDORG00000011790 transcript:ENSDORT00000011788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTNYDPDEDQLTSYDIQLSIQESIEASQPAPHLERFVPLSDQNRKLVEAIRQGHILELE
YEYHALDADEAWFLHEAVIPVQSELDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVKKGSYDMVSALIKYNTSLDQPCVKRWSAMHEAAKQGRKD
IIALLLKHGGNVLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVFALADDGASVLFDAAG
GGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKHLIPVTSKNAIQKSGLSPV
HSAADGQNAQCLQLLIENGFDVNMLLDDHISQSYDDERKTALYFAVSNNDIHCTEVLLAA
GADPNLDPLNCLLVAVRANNHEIVRLLLSHGANVNCYFMHVNDTRFPSVIQYALHDEVMM
RLLLNNGYQVEMCFDCMHGNIFGNSFVWTDIEEEILPGWTSCILKDTSFCEFITVPWMKH
LVGSIVRILIDYMDYVPLCAKLKSVLEIQREWPEIRQIL
Download sequence
Identical sequences ENSDORP00000011081 ENSDORP00000011081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]